PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C012077P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 465aa    MW: 52258.2 Da    PI: 6.848
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C012077P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.34.8e-152266348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +WT++Ed++l + ++q+G+++W+ Ia+++   +t  qc+ rw++yl
   MELO3C012077P1 22 SWTQQEDDILREQINQHGTENWAIIASKFK-DKTTRQCRRRWYTYL 66
                     6****************************9.*************97 PP

2Myb_DNA-binding45.22.2e-1472115146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g W++eEd+ll +a k +G++ W+ Ia+ +  gRt++ +k+r+ +
   MELO3C012077P1  72 KGGWSPEEDLLLCEAQKIFGNR-WTEIAKVVS-GRTDNAVKNRFTT 115
                      688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.9881566IPR017930Myb domain
SMARTSM007178.3E-141968IPR001005SANT/Myb domain
SuperFamilySSF466897.86E-2620113IPR009057Homeodomain-like
CDDcd001671.09E-122266No hitNo description
PfamPF139214.3E-152382No hitNo description
Gene3DG3DSA:1.10.10.602.3E-202374IPR009057Homeodomain-like
PROSITE profilePS5129420.82867121IPR017930Myb domain
SMARTSM007173.9E-1571119IPR001005SANT/Myb domain
CDDcd001671.32E-1075116No hitNo description
Gene3DG3DSA:1.10.10.604.8E-1975120IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MQDTKKKLAT EDSKKKERHI VSWTQQEDDI LREQINQHGT ENWAIIASKF KDKTTRQCRR  60
RWYTYLNSDF KKGGWSPEED LLLCEAQKIF GNRWTEIAKV VSGRTDNAVK NRFTTLCKKR  120
AKYEALAKEN SSSFINHNNK RVLFQKGSND VSSETSQPVK RIRRAHISHT TEGCLLEDGS  180
KKPGLAMDQQ PRAPFAVLVE NIVDNADGLS ATQSNKSQGT FIKKDDPKVT ALTEQAELLS  240
SLALKVNSEN TDQSLENAWK ILQDFLSRSK ENDTHITKYV TPDIDLQLED TKGSVEDLRS  300
SNDGSQWREP NLHESPGSSE YSTGSTLVSQ TAEEKIDQSQ PEIGTHHQEP QFESGSSCTR  360
EQYNIGESEK EILPKTNLER ETFKCCNERK IESIASSFSS SEFSSPMHVI PLFRSLAAGI  420
PSPQFSESER SFLLKTLGVE SPSLNPSVNP SQPPPCKRAL LQSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-272312110108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00259DAPTransfer from AT2G02820Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818961e-119LN681896.1 Cucumis melo genomic scaffold, anchoredscaffold00016.
GenBankLN7132641e-119LN713264.1 Cucumis melo genomic chromosome, chr_10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008446327.10.0PREDICTED: myb-like protein Q isoform X2
TrEMBLA0A0A0KVW30.0A0A0A0KVW3_CUCSA; Uncharacterized protein
STRINGVIT_01s0026g01910.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34803461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14350.21e-167MYB family protein